Molecular Reference

Terminology · Learn

How to Read a Peptide Sequence (Ac-, D-, NH2)

Learning how to read a peptide sequence means moving left to right, naming each amino acid, then decoding anything attached to the chain. In Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, Ac- caps the N-terminus, D-Phe changes handedness, c[...] marks a ring, and -NH2 caps the C-terminus.

Which direction do you read a peptide sequence?

Peptide sequences are read from the N-terminus on the left to the C-terminus on the right. The N-terminus is the amino end; the C-terminus is the carboxyl end. Chemical caps can change those end groups, but they do not change the reading direction. Reverse the residue order and you have described a different peptide.

Take Gly-His-Lys. Read it as glycine first, histidine second, lysine third. The compact version is GHK. Our amino acid sequence glossary entry covers why order defines the molecule; the amino acid reference covers the building blocks themselves.

How do one-letter and three-letter codes work?

The peptide amino acid codes are two alphabets for the same 20 standard residues. Three-letter codes make short, modified peptides easier to audit; one-letter codes save space in databases and long sequences. Case and punctuation matter once nonstandard residues or stereochemistry enter the line, so do not casually “clean up” a sequence copied from a paper.

Amino acid Codes Amino acid Codes
Alanine Ala / A Leucine Leu / L
Arginine Arg / R Lysine Lys / K
Asparagine Asn / N Methionine Met / M
Aspartate Asp / D Phenylalanine Phe / F
Cysteine Cys / C Proline Pro / P
Glutamate Glu / E Serine Ser / S
Glutamine Gln / Q Threonine Thr / T
Glycine Gly / G Tryptophan Trp / W
Histidine His / H Tyrosine Tyr / Y
Isoleucine Ile / I Valine Val / V

Nle means norleucine, a nonstandard residue with no standard one-letter code. PubChem therefore renders the first residue of Melanotan II as X in its compact XDHFRWK sequence, then preserves Nle in the more informative condensed notation. An X is a prompt to inspect the detailed record, not a mystery amino acid to guess.

What do Ac- and -NH2 mean on a peptide?

Ac- means N-terminal acetylation: an acetyl group covers the amino end. -NH2 means C-terminal amidation: the usual terminal carboxyl group is replaced by a carboxamide. Both are real parts of the molecule, not packaging notes, and leaving either off describes a different chemical structure.

What does Ac- mean on a peptide in practical terms? The cap can block enzymes called aminopeptidases from starting at the N-terminus. C-terminal amidation removes the usual negative terminal charge and can change receptor binding, shape, and resistance to breakdown. A review of peptide terminal modifications documents both uses. The honest wording is “can”: the effect depends on the peptide. A cap is not an automatic promise of a particular half-life.

What do D- and cyclic peptide notation mean?

D- identifies a mirror-image amino acid, while c[...] or cyclo[...] says that part of the peptide forms a ring. Most amino acids made by ribosomes are the L form. Proteases are shaped to recognize those familiar backbones, so a D-amino acid peptide often resists cleavage better. A review of protease-resistant peptide designs covers both D/retro-inverso construction and cyclization. That design advantage does not prove the modified peptide still binds its intended target.

One easy trap: D by itself in one-letter code means aspartate; D-Phe means D-phenylalanine. The hyphen and full residue name carry the stereochemistry.

Cyclic peptide notation also needs a source. Brackets announce a ring but do not always specify which atoms close it. Numbered residues, HELM notation, or a structure record supplies that missing bond. Cyclization can restrict a floppy chain and shield it from some proteases, but the biological result remains an experiment, not something punctuation settles.

How do you decode the Melanotan II sequence?

Melanotan II is the useful worked example because its short label contains nearly every common modification: Ac-Nle-c[Asp-His-D-Phe-Arg-Trp-Lys]-NH2. PubChem CID 92432 confirms the seven-residue identity as Ac-Nle-Asp(1)-His-D-Phe-Arg-Trp-Lys(1)-NH2; the matching (1) marks identify the ring closure.

Read the label in five passes:

  1. Ac- caps the N-terminus.
  2. Nle is norleucine, placed outside the six-residue ring.
  3. c[Asp-His-D-Phe-Arg-Trp-Lys] is the cyclic core.
  4. D-Phe is mirror-image phenylalanine; the other named chiral residues are L unless marked otherwise.
  5. -NH2 amidates the C-terminus.

The ring is a lactam bond between the side-chain carboxyl group of Asp and the side-chain amino group of Lys. The published Melanotan II synthesis confirms that bond and the complete sequence. Melanotan II’s design does more than dodge proteases: norleucine replaced oxidation-sensitive methionine, D-Phe changed stability and activity, and cyclization held the active region in a tighter shape. Those are chemical design facts. They do not make a printed label proof that a vial contains Melanotan II.

What does D-retro-inverso mean in FOXO4-DRI?

FOXO4-DRI shows why a bare one-letter string can hide crucial chemistry. “DRI” means D-retro-inverso: researchers reverse the residue order and replace the chiral amino acids with D forms. The goal is to present side chains in a roughly parent-like arrangement while making the backbone less familiar to proteases.

PubChem CID 167312269 gives the 46-residue one-letter field as LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG. That string alone looks ordinary. PubChem’s condensed field is the essential second layer: it marks every chiral residue D-; glycine has no D/L label because glycine is achiral. The 2017 FOXO4-DRI paper tested the design in cultured human cells and mice, not in a human clinical trial.

That separation is the useful evidence ladder. The reliable way to learn how to read a peptide sequence is to separate the notation claim from the evidence behind the molecule. A PubChem record can verify what sequence a name denotes. A chemistry paper can explain why a modification was chosen. Cell, animal, and human studies separately test what the molecule does. None of those facts proves the contents of a particular vial, and a sequence printed on a label is not a purity or identity test. Use the guide to spotting quality peptide documentation, then keep biological claims on their proper rungs with the evidence-grading guide.

Sources

  1. 1.Melanotan II — PubChem CID 92432NIH
  2. 2.FOXO4-DRI — PubChem CID 167312269NIH
  3. 3.Baar et al., 2017 — FOXO4-DRI design and preclinical evidence (PMID 28340339)NIH
  4. 4.Sanchez-Navarro et al., 2021 — Protease-resistant peptides (PMID 34959346)NIH

Related compounds

Keep learning

← All explainers